DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and prss36

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:291 Identity:86/291 - (29%)
Similarity:131/291 - (45%) Gaps:46/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGRSISCLDMGHGIG-----GRIAGGELARANQFPYQVGLSIEEPNDMYCW 60
            |:::...:.||..|....:|........|     .||.||..||...:|:||.|.....:    .
 Frog     1 MELTETFLLLLAFVSPTIVSTTPAPPSCGSPLVSSRIVGGTDAREGAWPWQVSLRYRGSH----I 61

  Fly    61 CGASLISDRYLLTAAHCVEKAVAITYY--LGGVLRLA---PRQLIRSTNPEVHLHPDWNCQSLEN 120
            ||.|:|..:::||||||...:.:.:.|  ..|..|||   |.::....: .:.:||.::..:...
 Frog    62 CGGSVIGTQWILTAAHCFGNSQSPSDYEVRLGAYRLAETSPNEITAKVD-RIIMHPQYDELTYFG 125

  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSY-DYVPAIASGWGRMNDESTAISDNLRYVYRFVE 184
            ||||:||.........|.|:.||   |:.||: |.:....:|||:     ||.:.||.:.....|
 Frog   126 DIALIRLTSPIDYTAYILPVCLP---SASNSFTDGMECWVTGWGK-----TAFNVNLPFPGTLQE 182

  Fly   185 ------SNEDCEYSY---------ANIKPTN-ICMD-TTGGKSTCTGDSGGPLVYSDPVQNADIL 232
                  :...|:..|         :.|.|:: ||.. :.|||.:|.|||||.||..  :|.....
 Frog   183 VMTPLINRTRCDQMYHIDSPVSASSEIIPSDQICSGYSDGGKDSCKGDSGGALVCK--IQRVWYQ 245

  Fly   233 IGVTSYGKKSGCT-KGYPSVFTRITAYLDWI 262
            ||:.|:|  .||. ...|.|:|.:.||..|:
 Frog   246 IGIVSWG--DGCAIANRPGVYTLVPAYQSWL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/254 (31%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113 79/255 (31%)
Tryp_SPc 385..622 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.