DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and cela1.6

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:247 Identity:82/247 - (33%)
Similarity:128/247 - (51%) Gaps:21/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG--GVLR 93
            |:.|||:||.|.:|:|:.|........|..||.:||...::|||||||:.:......||  .:.:
Zfish    29 RVVGGEVARPNSWPWQISLQYLSGGSYYHTCGGTLIKQNFVLTAAHCVDTSRTWRVVLGEHDIYK 93

  Fly    94 LAPRQLIRSTNPEVHLHPDWNCQSLE--NDIALVRLPEDALLCDSIRPIRLP--GLSSSRNSYDY 154
            ...|:...:.: .|::||:||..::.  .||||:||..:|.|...::...||  |.....|:..|
Zfish    94 QEGREQYMTVS-NVYIHPNWNRNNVAAGYDIALLRLSSNASLNTYVQLGTLPPSGQVLPHNNACY 157

  Fly   155 VPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC---EYSYANIKPTNICMDTTGGKSTCTGDS 216
            :    :||| :.....::|..|:..|..|.....|   ::..:.:|.|.:|.. .|..|.|.|||
Zfish   158 I----TGWG-LTSTGGSLSAQLKQAYLPVVDYNTCSRGDWWGSTVKNTMVCAG-GGSLSGCQGDS 216

  Fly   217 GGPLVYSDPVQNADILIGVTSYGKKSGCTKGY--PSVFTRITAYLDWIGEVS 266
            ||||  :..|....::.||||:...||| ..|  |:||||::||:.||..::
Zfish   217 GGPL--NCQVSGQYVVHGVTSFVSSSGC-NAYQKPTVFTRVSAYISWINGIA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 80/241 (33%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.