DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and cela1.5

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001003450.1 Gene:cela1.5 / 445056 ZFINID:ZDB-GENE-040801-186 Length:274 Species:Danio rerio


Alignment Length:255 Identity:77/255 - (30%)
Similarity:116/255 - (45%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEE-PNDMYC-WCGASLISDRYLLTAAHCVEKAVAITYYLGGVLR 93
            |:.|||:|:.:.:|:||.:.|:. ..|.|. :|..:||...|:||:.|.:     .:.|  |..|
Zfish    29 RVVGGEIAKPHSWPWQVSVQIKTLSQDSYTHYCAGTLIRKNYVLTSVHSI-----FSKY--GSWR 86

  Fly    94 L-----------APRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSS 147
            :           ...|.|.......|.:.|.|..|..||:||::|..||.|...::...||    
Zfish    87 VVLGDHDISTDEGTEQYIEVREITFHAYSDLNDVSKGNDVALLKLASDANLNAYVQLAPLP---- 147

  Fly   148 SRNSY---DYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYS---YANIKPTNICMDTT 206
             |:..   ...|...:|||....:. :.|..|:..|..|..:|.|..|   .:.:|.|.:|    
Zfish   148 -RHKQILPHGTPCFTTGWGNTETDG-SFSAELKQAYLPVVDHETCSQSDWWGSTVKDTMVC---- 206

  Fly   207 GGKST---CTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWI 262
            ||..|   |.||.||||  |..|....::.|:.|:....||. ...|::|||::||:|||
Zfish   207 GGDGTMAVCKGDFGGPL--SCLVDGKYVVYGIASFMSSEGCNIYKKPTIFTRVSAYVDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/253 (30%)
cela1.5NP_001003450.1 Tryp_SPc 29..264 CDD:214473 75/253 (30%)
Tryp_SPc 30..264 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.