DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and KLK14

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:243 Identity:71/243 - (29%)
Similarity:117/243 - (48%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRL- 94
            :|.||.....:..|:|..| :..|...:. ||.:|:|.::::|||||....:.:......:.|. 
Human    24 KIIGGHTCTRSSQPWQAAL-LAGPRRRFL-CGGALLSGQWVITAAHCGRPILQVALGKHNLRRWE 86

  Fly    95 APRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL------PGLSSSRNSYD 153
            |.:|::|......  ||::|.::.:||:.|::|.:.|.:..::|||.:      ||.|..     
Human    87 ATQQVLRVVRQVT--HPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCR----- 144

  Fly   154 YVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMDT-TGGKSTCTGDS 216
                 .||||.::........:|:.|...:..:|.|:.:| ..|.|..:|... .|||.:|.|||
Human   145 -----VSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDS 204

  Fly   217 GGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGE 264
            |||||....:|      |:.|:|.:.....|||.|:|.:..|..||.|
Human   205 GGPLVCRGQLQ------GLVSWGMERCALPGYPGVYTNLCKYRSWIEE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/239 (28%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.