DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Try10

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:239 Identity:79/239 - (33%)
Similarity:118/239 - (49%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG----GV 91
            :|.||...|.|..||||.|     |..|.:||.|||:|:::::||||.:..:.:.  ||    .|
Mouse    23 KIVGGYTCRENSVPYQVSL-----NSGYHFCGGSLINDQWVVSAAHCYKSRIQVR--LGEHNINV 80

  Fly    92 LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVP 156
            |. ...|.|.:.|  :..||.:..::|:|||.|::|.....|...:..:.||...::..:    .
Mouse    81 LE-GNEQFIDAAN--IIKHPKFKKKTLDNDIMLIKLSSPVTLNARVATVALPSSCAAAGT----Q 138

  Fly   157 AIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMD-TTGGKSTCTGDSGGP 219
            .:.||||..........|.|:.:...:....|||.|| ..|....||:. ..|||.:|.||||||
Mouse   139 CLISGWGNTLSSGVNNPDLLQCLDAPLLPQADCEASYPGKITKNMICVGFLEGGKDSCQGDSGGP 203

  Fly   220 LVYSDPVQNADILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWI 262
            :|.:..:|      |:.|:|  .||. |..|.|:|::..|:|||
Mouse   204 VVCNGQLQ------GIVSWG--YGCAQKDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/237 (32%)
Try10NP_001034085.1 Tryp_SPc 23..239 CDD:214473 77/237 (32%)
Tryp_SPc 24..242 CDD:238113 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.