DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Jon99Fi

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:245 Identity:94/245 - (38%)
Similarity:130/245 - (53%) Gaps:13/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVL 92
            |.|||..|..|...:.||.|||......:.  |||.|:|.:.::||||||...|..:|...|..|
  Fly    34 IQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSIIGNTWVLTAAHCTNGASGVTINYGASL 96

  Fly    93 RLAPR--QLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYV 155
            |..|:  ..:.|.|...|.|  :|..:|.|||:|:|.|. ......:..:.||..:.....|...
  Fly    97 RNQPQYTHWVGSGNFVQHHH--YNSGNLHNDISLIRTPH-VDFWHLVNKVELPSYNDRYQDYAGW 158

  Fly   156 PAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPL 220
            .|:|||||...|.| .:.|.|:.|...:.|..||..:: ::....||::|.||||||.|||||||
  Fly   159 WAVASGWGGTYDGS-PLPDWLQAVDVQIMSQSDCSRTW-SLHDNMICINTNGGKSTCGGDSGGPL 221

  Fly   221 VYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270
            |    ....:.|:||||:...:||..|.|:||:|:|.|||||.:.:|:.|
  Fly   222 V----THEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTGISY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 88/232 (38%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 88/232 (38%)
Tryp_SPc 38..262 CDD:238113 89/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.080

Return to query results.
Submit another query.