DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG9733

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:269 Identity:82/269 - (30%)
Similarity:131/269 - (48%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GHGIGGRIAGGELARANQFPYQVGLSI--EEPNDMYCWCGASLISDRYLLTAAHC----VEKAVA 83
            |.||..||..|:....|:||:.|.|..  ...|.:...|..|||:.||:||||||    :|:.|.
  Fly   155 GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVG 219

  Fly    84 --ITYYLG------------GVLRLAPRQLIRSTNPEVHLHPDWN--CQSLENDIALVRLPEDAL 132
              ::..||            |....:| ::.|....|:.:|..::  ..:..:||.|:|:..:..
  Fly   220 TLVSVRLGEHDTRTAVDCPPGGGSCSP-EVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVR 283

  Fly   133 LCDSIRPIRLP---GLSSSRNSYDYVPAIASGWGR-MNDESTAISDNLRYVYRFVESNEDCEYSY 193
            ..|:|:||.||   ||.|.::...:..|   |||| :....:|:..  :....:|:..: |...:
  Fly   284 YSDNIQPICLPSSVGLESRQSGQQFTVA---GWGRTLKMARSAVKQ--KVTVNYVDPAK-CRQRF 342

  Fly   194 A----NIKPTNICMDTTGGKSTCTGDSGGPLV-YSDPVQNADILIGVTSYGKKSGCTKGYPSVFT 253
            :    |::||.:|......|.:|.|||||||: :.|   .:.:|.|:.|:|.|.| .|.:|.|:|
  Fly   343 SQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRD---ESWVLEGIVSFGYKCG-LKDWPGVYT 403

  Fly   254 RITAYLDWI 262
            .:.||..||
  Fly   404 NVAAYDIWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/261 (30%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 77/261 (30%)
Tryp_SPc 162..415 CDD:238113 78/262 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.