DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG9737

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:286 Identity:87/286 - (30%)
Similarity:122/286 - (42%) Gaps:60/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYY 87
            :.|..:..||.|||:|..::||: :.|.:...||.  .|..:||.||::|||||||:        
  Fly   141 ECGKQVTNRIYGGEIAELDEFPW-LALLVYNSNDY--GCSGALIDDRHILTAAHCVQ-------- 194

  Fly    88 LGGVLRLAPRQLIR---------STNPE---------------------VHLHPDWN--CQSLEN 120
             |..:|  .||.::         .|.|:                     :|:||::.  .....|
  Fly   195 -GEGVR--DRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYN 256

  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMN-------DESTAISDNLRY 178
            |||::||.........:.||.||..|......:......|||||.:       :..:.|...||.
  Fly   257 DIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRI 321

  Fly   179 VYRFVESNEDC----EYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYG 239
            .|   .|||:|    |.....:.|..||......|.||.|||||||:|.|...:..:..||.|||
  Fly   322 PY---VSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYG 383

  Fly   240 KKSGCTKGYPSVFTRITAYLDWIGEV 265
            .......|.|:|:|.:..|.|||..|
  Fly   384 FTQCGMAGKPAVYTNVAEYTDWIDSV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/273 (30%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 83/273 (30%)
Tryp_SPc 150..409 CDD:238113 84/275 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.