DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG7829

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:275 Identity:71/275 - (25%)
Similarity:119/275 - (43%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAA 75
            |:|:|  :..||.:......||.||..|.....||.|.:.:...:.    ||.|:|::..:|||.
  Fly     9 LLLLQ--ASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHH----CGGSIINNHTILTAG 67

  Fly    76 HCVEKAVAITYYLGGVLRLAPRQLIR----STN-----------PEVHLHPDWNCQSLENDIALV 125
            ||          |.||    |.:|::    .|:           .::.:|.::|.::::.||.::
  Fly    68 HC----------LNGV----PHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGII 118

  Fly   126 RLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWG--RMNDESTAISDNLRYVYRFVESNED 188
            ||.::..|...::.|.:.....:..:|    |..:|||  .||...   ||:|||....:.:...
  Fly   119 RLTKNLTLSRKVKAIPINPERVAEGTY----ATIAGWGFKSMNGPP---SDSLRYARVPIVNQTA 176

  Fly   189 CEYSYA-NIKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYPS 250
            |..... .:....:|.. ..||...|..||||||...:.      |:|:.|:|  .||. ...|.
  Fly   177 CRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQ------LVGIVSWG--VGCALADKPG 233

  Fly   251 VFTRITAYLDWIGEV 265
            |::|:.|...|:.:|
  Fly   234 VYSRLDALHPWLDQV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 64/250 (26%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 64/249 (26%)
Tryp_SPc 28..248 CDD:238113 64/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.