DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG11843

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:286 Identity:87/286 - (30%)
Similarity:125/286 - (43%) Gaps:59/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVQGRSIS--CLDMGHGIGGRIAGGELARANQFPYQVGLSIE-EPNDMYCW-CGASLISDRYLLT 73
            |:.|.||.  .:|........|.||..|:..:||:...|... :|:....| ||..|||:|::||
  Fly    47 LLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLT 111

  Fly    74 AAHCVEKAVAITYYLGGVLRL------------APRQLIRSTNPEVHLHPDWNCQSLENDIALVR 126
            ||||:|......    .|:||            |||..:.:   ....||.:......:||.||:
  Fly   112 AAHCLESERGEV----NVVRLGELDFDSLDEDAAPRDYMVA---GYIAHPGYEDPQFYHDIGLVK 169

  Fly   127 LPEDALLCDSIR-PIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAI----SDNL------RY-- 178
            |.| |::.|..: |..|| ....|:|..:   ||.|||     ||.:    |..|      ||  
  Fly   170 LTE-AVVFDLYKHPACLP-FQDERSSDSF---IAVGWG-----STGLALKPSAQLLKVKLQRYGN 224

  Fly   179 ------VYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGP-LVYSDPVQNADILIGVT 236
                  :.|.||     |:.........:|:.:...:.||.|||||| |:|........:::|:|
  Fly   225 WVCKKLLTRQVE-----EFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGIT 284

  Fly   237 SYGKKSGCTKGYPSVFTRITAYLDWI 262
            |.|...| :.|.|.::||:..||.||
  Fly   285 SAGLSCG-SPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 80/264 (30%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 82/265 (31%)
Tryp_SPc 68..309 CDD:214473 80/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.