DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG4815

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:230 Identity:62/230 - (26%)
Similarity:90/230 - (39%) Gaps:60/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GLSIEEPNDMYCWCGASLISDRYLLTAAHCVE------------KAVAITYYLGGVLRLAPRQLI 100
            |:.|:..|.....|.|:|::.|::||||||.|            |:...|::.....:   .:||
  Fly    48 GVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNK---NKLI 109

  Fly   101 RSTNPEVHLHPDWNCQSLENDIALVRLPED--------ALLCDSIRPIRLPGLSSSRNSYDYVPA 157
            |     |.:||.:.......|:|:.:....        |.||.|:...|           |.:  
  Fly   110 R-----VQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPR-----------DKL-- 156

  Fly   158 IASGW---GRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTN-ICMDTTGGKSTCTGDSGG 218
            ||:||   |.:.|||.  ....|.:...:.|..|||.......|.| ||......|:.|.|||||
  Fly   157 IAAGWGFEGGVWDESR--KKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGG 219

  Fly   219 PLVYSDPV-------------QNADILIGVTSYGK 240
            ||:....|             :..|:.:||..|.|
  Fly   220 PLLLGRQVCGINTWTFKCGNNEKPDVYMGVRYYAK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 62/230 (27%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 61/229 (27%)
Trypsin 49..256 CDD:278516 61/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.