DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG11836

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:259 Identity:75/259 - (28%)
Similarity:118/259 - (45%) Gaps:59/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLR-- 93
            ||.||:....||:|:...:..    |....||.||::..|:|:|||||:|           ||  
  Fly    96 RIVGGKPTGVNQYPWMARIVY----DGKFHCGGSLLTKDYVLSAAHCVKK-----------LRKS 145

  Fly    94 -------------LAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGL 145
                         .:..|.|:.....|..|..::..:..|||||:||.:.......|:||.||  
  Fly   146 KIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLP-- 208

  Fly   146 SSSRNSYDYVPA----IASGWGRMND--ESTAISDNLRYVYRFVESNEDCEYSYANIKPTNIC-- 202
                 .|:|.||    ...||||.::  |..:|.:.::.....:....:..|....|..:.:|  
  Fly   209 -----RYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG 268

  Fly   203 ---MDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWI 262
               ||      :|.|||||||:.|:.|:.  .::|:.|:|  .|| .:|||.|::|::.::.||
  Fly   269 RPSMD------SCQGDSGGPLLLSNGVKY--FIVGIVSWG--VGCGREGYPGVYSRVSKFIPWI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/257 (28%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.920

Return to query results.
Submit another query.