DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG7142

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:276 Identity:78/276 - (28%)
Similarity:115/276 - (41%) Gaps:83/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ARANQFPYQVGLSIEEPND-MYCWCGASLISDRYLLTAAHC------VEKAVAIT---------- 85
            |..:..||.|.:.:..|:. :..:|..::|::.::||||||      ||.:|.:.          
  Fly    86 ATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKG 150

  Fly    86 -----------------YYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALL 133
                             .|||||            ||              .||||:...|..:.
  Fly   151 EASNIQMRHIDYYVRHELYLGGV------------NP--------------YDIALIYTKEPLVF 189

  Fly   134 CDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESN------EDCEYS 192
            ...::|..||...:....|    ....|||  |...||:.:   |.:|..|:|      |.||..
  Fly   190 DTYVQPATLPEQDAQPEGY----GTLYGWG--NVSMTAVPN---YPHRLQEANMPILDMELCEQI 245

  Fly   193 YAN----IKPTNICM-DTTGGKSTCTGDSGGPLVY---SDPVQNADILIGVTSYGKKSGCTKGYP 249
            .|.    :..||:|. ..|||.|.||.||||||:.   .:..:.|:|:||:.|:||.....|..|
  Fly   246 LARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAP 310

  Fly   250 SVFTRITAYLDWIGEV 265
            |||.|::|:.:||.:|
  Fly   311 SVFVRVSAFTEWINQV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/271 (28%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 77/274 (28%)
Tryp_SPc 84..323 CDD:214473 75/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.