DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG5255

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:254 Identity:69/254 - (27%)
Similarity:114/254 - (44%) Gaps:55/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV--EKAVAITYYLG---- 89
            ||.|||.|.|...|||:  |::........||.::|.:|:::|||||.  .:|.|.....|    
  Fly    29 RIVGGEEAAAGLAPYQI--SLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDL 91

  Fly    90 ---GVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL------PGL 145
               |.....|.:::.        |.::..:...|||||:.|.|..:..::.:|:.|      || 
  Fly    92 HQNGSKYYYPDRIVE--------HSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPG- 147

  Fly   146 SSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESN----EDCEYSYAN---IKPTNICM 203
              ||       .:.:|||.:     ::..::....:.:|.|    |.|..::.|   :...::|.
  Fly   148 --SR-------LLLTGWGTL-----SLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCT 198

  Fly   204 DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            ....|:..|.||||||||::..      |:.:.::|..  |.||||.....|:.|.|:|
  Fly   199 FNDKGRGACHGDSGGPLVHNGK------LVALVNWGLP--CAKGYPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/252 (27%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/252 (27%)
Tryp_SPc 30..252 CDD:238113 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.