DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG5246

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:128/281 - (45%) Gaps:42/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCL------DMGHGIG-----GRIAGGELARANQFPYQVGLSIEEPNDMYC 59
            :|:.:|:::...|...:      .:.|.:|     .|:.||..:.....||||.:.......:  
  Fly     5 VLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHV-- 67

  Fly    60 WCGASLISDRYLLTAAHCVEKAVAITYYLGGVL---RLAPRQLIRSTNPEVHLHPDWNCQSLEND 121
             ||.|:|:.:::||||||:|..:.....:.|.:   |.....|:..:.    :|...:..:..||
  Fly    68 -CGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSK----IHCSHDKPAYHND 127

  Fly   122 IALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASG----WGRMNDESTAISDNLRYVYRF 182
            |||:...:..:..|..:||:|....|.....|.:.....|    |||.:.:...|  :|.|:   
  Fly   128 IALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKI--DLNYI--- 187

  Fly   183 VESNEDCEYSYAN---IKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC 244
              .:::|:....|   :...::|..|..|:.:|.||||||||.::     ..|:||.::|:  .|
  Fly   188 --DHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDAN-----QTLVGVVNWGE--AC 243

  Fly   245 TKGYPSVFTRITAYLDWIGEV 265
            ..|||.||..:..|.|||.::
  Fly   244 AIGYPDVFGSVAYYHDWIEQM 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 66/240 (28%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 66/240 (28%)
Tryp_SPc 42..263 CDD:238113 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.