DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG17475

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:319 Identity:86/319 - (26%)
Similarity:124/319 - (38%) Gaps:94/319 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCLDM---------------GHGIGGRIAGGELARANQFPYQVGLSIEEPN 55
            |||.||.....:.||.:.:               |.....|:..||..:..:..||:.|     .
  Fly     9 ILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISL-----Q 68

  Fly    56 DMYCW--CGASLISDRYLLTAAHCV-----------------EKAVAITYYLGGVLRLAPRQLIR 101
            .||..  ||..:|.:|::|||||||                 ||..|: |::             
  Fly    69 GMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAV-YFV------------- 119

  Fly   102 STNPEVH-LHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRM 165
                |.| :|.::|.....|||||:||.:.....:..:|..||....:..:    ..:.:|||  
  Fly   120 ----EEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGT----QLLLTGWG-- 174

  Fly   166 NDESTAI----SDNLRYVYRFVESNEDCEYSYANIKPTN----ICMDTTGGKSTCTGDSGGPLVY 222
               ||.:    .|.|:..|........|: ...|..|:|    ||..||||:..|.|||||||.:
  Fly   175 ---STELWGDTPDILQKAYLTHVVYSTCQ-EIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTH 235

  Fly   223 SDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI-----GEVSGVH-----YP 271
            :      .:|.|:.::|..  |..|.|.....:..||:||     |..|..|     ||
  Fly   236 N------GVLYGLVNWGYP--CALGVPDSHANVYYYLEWIRSMISGPCSNCHCYASNYP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 71/258 (28%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/258 (28%)
Tryp_SPc 50..269 CDD:238113 72/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.