DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG31265

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:251 Identity:76/251 - (30%)
Similarity:117/251 - (46%) Gaps:32/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GIGGRIAGGELARANQFPYQVGLS--IEEPNDMYCWCGASLISDRYLLTAAHCVEKAV-AITYYL 88
            |..|||.|||.|.....||||.|.  :...|     ||.:::::.:::||.||||..: |:...:
  Fly    32 GQSGRIKGGEEAEIGFAPYQVSLQPIVGSHN-----CGGAILNENWIITAGHCVENFIPALVNVI 91

  Fly    89 GGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYD 153
            .|..:.|....|..| .|:|.|..::...:.||||||:|.|:....:..:||.||    :|....
  Fly    92 TGTNKWAEPGAIYYT-AEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALP----TRPVQL 151

  Fly   154 YVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPT------NICMDTTGGKSTC 212
            ....:.:|||    ...|...::..:::........:..|.....|      :||..:..|:..|
  Fly   152 GEEIVLTGWG----SDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGAC 212

  Fly   213 TGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI-GEVSG 267
            .||||||||.:..      |:||.::|:.  |..|.|.|...:..||||| .::||
  Fly   213 HGDSGGPLVSNGQ------LVGVVNWGRP--CGVGLPDVQANVYYYLDWIRSKLSG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/239 (29%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 70/239 (29%)
Tryp_SPc 39..257 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.