DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG17477

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:282 Identity:77/282 - (27%)
Similarity:127/282 - (45%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGRSISC--LDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGA 63
            |.::..|.::|:.   .|:.|  |.:.|    .|.||:.|.....||||.|.....:.:   ||.
  Fly     1 MSLARFLFYILVF---SSLYCDLLALEH----FIVGGQNAAEGDAPYQVSLQTLLGSHL---CGG 55

  Fly    64 SLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNP-------EVHLHPDWNCQSLEND 121
            ::||||:::||.|||:.      |....|::| ...||...|       .::||.:::....:||
  Fly    56 AIISDRWIITAGHCVKG------YPTSRLQVA-TGTIRYAEPGAVYYPDAIYLHCNYDSPKYQND 113

  Fly   122 IALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESN 186
            |.|:.|.|........:.:.||.....|.:.:.|   .:|||..: .:.::...|:.|.:...::
  Fly   114 IGLLHLNESITFNALTQAVELPTSPFPRGASELV---FTGWGSQS-AAGSLPSQLQRVQQQHLNS 174

  Fly   187 EDCE-----YSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK 246
            ..||     |....:.|.:||.........|.||||||||:.      ..|:|:.::...  |.:
  Fly   175 PACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQ------GTLVGILNFFVP--CAQ 231

  Fly   247 GYPSVFTRITAYLDWIGE-VSG 267
            |.|.:|..|..|.||:.: :||
  Fly   232 GVPDIFMNIMYYRDWMRQTMSG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/242 (28%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/244 (28%)
Tryp_SPc 27..246 CDD:214473 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.