DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG9631

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:255 Identity:61/255 - (23%)
Similarity:95/255 - (37%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV--EKAVAITYYLGGVLRLAP 96
            ||:|....|:|:...| .|........|..|:||.|.::|||||:  :.|..:..|||       
  Fly   199 GGDLVTRGQYPWLAAL-YEGVGTATYKCVVSVISKRTVITAAHCIYGKSASQLWVYLG------- 255

  Fly    97 RQLIRSTNPEVHLHPDWNCQSL------------------ENDIALVRLPEDALLCDSIRPIRLP 143
             :..|:.|||       |..||                  :.|:.|:.|....:....|||:.|.
  Fly   256 -RHDRNENPE-------NGASLVSVTSVLTPSAYEGNPVPDADVGLLVLTSPMVYTKYIRPLCLW 312

  Fly   144 GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC--EYSYAN--IKPTNICMD 204
            |.:......:......:|||  .|.|...:...:.|...:...:.|  |...|.  |....:|..
  Fly   313 GSNMGLPPNEGDTGAVAGWG--YDRSAQKTRFPKTVSVRLVPRDQCLKEMKRAEDFITRRTVCAG 375

  Fly   205 TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSG--CTKGYPSVFTRITAYLDWI 262
            .:.....|.||||..|:...  .|...:.||.|...:.|  |......::..:..::||:
  Fly   376 NSESHGPCFGDSGSALIVLR--NNRWYVRGVVSLSPRHGEICDLSKYVIYCDVARHIDWV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 60/253 (24%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 61/255 (24%)
Tryp_SPc 198..433 CDD:214473 60/253 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.