DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG8870

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:263 Identity:76/263 - (28%)
Similarity:114/263 - (43%) Gaps:47/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GELARANQFPYQVGLSIEEPND----MYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            |::...|:||:...|.....|:    :...||.|||::.|:||||||||.......|....:||.
  Fly    87 GKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLG 151

  Fly    96 PRQLIRSTNP---------------------EVHLHPDWN-CQSLENDIALVRLPEDALLCDSIR 138
            ...  .||||                     ::..|..:| .:.|.||||||||........:|:
  Fly   152 EHN--TSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQ 214

  Fly   139 PIRLP---GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNED-CEYSYANIKPT 199
            ||.||   .|::.:..:.     ||||   .|....|:..:.......|.:.| |:.:|.....:
  Fly   215 PICLPRAQKLAAHKRKFQ-----ASGW---PDMGQGIASEVLLRSFIAERHPDVCKSNYDFNLGS 271

  Fly   200 NICMDTTGGKSTCTGDSGGPLVYSDPVQNADILI----GVTSYGKKSGCTKG-YPSVFTRITAYL 259
            .||.....|..|..|||||||:  :.|....:.:    |:.|||:|....|. .|:.:|:.:.:.
  Fly   272 QICAGGLDGNDTSPGDSGGPLM--ETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFF 334

  Fly   260 DWI 262
            :||
  Fly   335 EWI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/261 (28%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 75/257 (29%)
Tryp_SPc 93..337 CDD:214473 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.