DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and snk

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:287 Identity:86/287 - (29%)
Similarity:128/287 - (44%) Gaps:55/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSISCLDMGHGIGGR--------IAGGELARANQFPYQVGL-----SIEEPNDMYCWCGASLISD 68
            |.:...|.|....|:        |.||...|...||:...|     |..:..|:...||.:|:|:
  Fly   163 RRLHLTDTGRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSE 227

  Fly    69 RYLLTAAHCVEKAVAITYYLGG----VLRLAPRQLIRSTNPE-------VHLHPDWNCQSLENDI 122
            .|:||||||...        |.    ::||..|||..::..:       :.|||.:...:..:||
  Fly   228 LYVLTAAHCATS--------GSKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDI 284

  Fly   123 ALVRLPEDALLCDSIRPI---RLPGLSSSRNSYDYVP-AIASGWGRMNDESTAISDNLRYVYRFV 183
            ||::|.......:.:||.   :||.|.        :| .:|:|||| .:...|.|:.||.|...|
  Fly   285 ALLKLTRRVKFSEQVRPACLWQLPELQ--------IPTVVAAGWGR-TEFLGAKSNALRQVDLDV 340

  Fly   184 ESNEDCEYSYANIK--PTNI-----CMD-TTGGKSTCTGDSGGPLVYSDPVQN-ADILIGVTSYG 239
            .....|:..|...:  |..|     |.. ..||:.||.||||||:....|..| ...::|:||:|
  Fly   341 VPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFG 405

  Fly   240 KKSGCTKGYPSVFTRITAYLDWIGEVS 266
            |....... |.|:||:.:|||||.:::
  Fly   406 KFCAAPNA-PGVYTRLYSYLDWIEKIA 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 80/267 (30%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 82/261 (31%)
Tryp_SPc 186..427 CDD:214473 80/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.