DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG12951

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:134/277 - (48%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDR 69
            :::|.|.:...|::...:       .|:..|..:...::|:.|.|...:.:..   ||.|:||..
  Fly    10 SLIVILAVTTVGQAAPSI-------SRVVNGTDSSVLKYPFVVSLRSYDGSHS---CGGSIISKH 64

  Fly    70 YLLTAAHCVE----KAVAITYYLGGVLRLAP-----RQLIRSTNPEVHLHPDWN-CQSLENDIAL 124
            :::|||||..    ..::|.:.:..:..:.|     :::|:        |.|:: .:...|||:|
  Fly    65 FVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQ--------HEDFDPTRQNANDISL 121

  Fly   125 VRLPE----DALLCDSIRPIRLPGLSSSRNSYDY-VPAIASGWGRMNDESTAISDNLRYVYRFVE 184
            :.:.|    |.:   |:.|:.||.|:.:....|. |..:..||| :||...::.|.|:.|...:.
  Fly   122 LMVEEPFEFDGV---SVAPVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIY 182

  Fly   185 SNEDCEYSY-ANIKPT-NIC--MDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT 245
            |:|:|...: ....|. :||  :| .|||..|:|||||||:|:..      .:|:.|:..|....
  Fly   183 SDEECTSRHNGQTDPKYHICGGVD-EGGKGQCSGDSGGPLIYNGQ------QVGIVSWSIKPCTV 240

  Fly   246 KGYPSVFTRITAYLDWI 262
            ..||.|:.:::.|:|||
  Fly   241 APYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/249 (27%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 68/249 (27%)
Tryp_SPc 30..260 CDD:238113 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.