DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG13318

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:118/288 - (40%) Gaps:65/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPND----MYCW------------CGASLISD 68
            |.|...:|:......|......:||...|.:...|..    .|.|            .|.:||:.
  Fly   132 STLTCSYGLVACCQAGSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALITA 196

  Fly    69 RYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNP---------EVHLHPDWNCQSLENDIAL 124
            :::|||||.|.. :.:||:   .:||.......::.|         .|:::|.:|..:|:||:|:
  Fly   197 QHVLTAAHKVYN-LGLTYF---KVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAI 257

  Fly   125 VRL--PEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVE--- 184
            ::|  |.......::..:.||     ..|:.......:|||:.:..:|.       .|:.:|   
  Fly   258 LKLSTPVSLTSKSTVGTVCLP-----TTSFVGQRCWVAGWGKNDFGATG-------AYQAIERQV 310

  Fly   185 -----SNEDCEY--------SYANIKPTN-ICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGV 235
                 .|.:|:.        |...:.||: ||.....||..||||.|.|||.:.  .....::|:
  Fly   311 DVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTS--NGVWYVVGL 373

  Fly   236 TSYGKKSGCTK-GYPSVFTRITAYLDWI 262
            .::|  .||.: |.|.|:..:..||.||
  Fly   374 VAWG--IGCAQAGVPGVYVNVGTYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/275 (24%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 62/251 (25%)
Tryp_SPc 169..399 CDD:214473 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.