DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss46

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006244055.1 Gene:Prss46 / 408245 RGDID:1302970 Length:314 Species:Rattus norvegicus


Alignment Length:266 Identity:62/266 - (23%)
Similarity:117/266 - (43%) Gaps:49/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAV 82
            :|||         ::..|::....::|:||.:..   ..||. |..|||...::||||||::::.
  Rat    39 NISC---------KVVNGKVVEVGKWPWQVSILF---LGMYI-CSGSLIHHHWVLTAAHCLQRSK 90

  Fly    83 AITYYLGGVLRLAPRQLIRSTNPE-----VHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL 142
            ....|   .:::..:.|..:::.|     :.:|.:: ...:.:|||:::|.........|:||.|
  Rat    91 NPANY---TVKVGVQTLPDNSSSELLVTSIVIHENF-INHMSHDIAILKLKYPVTWSPFIQPICL 151

  Fly   143 PGLSSSRNSYDYVPAIAS-----GWGRMNDESTAISD-NLRYVYRFVESNEDCEYSYANIKPTN- 200
            |       ..::.|:|.:     |||....:....:. :::.|...:.:||.|.:.|..:...| 
  Rat   152 P-------EVNFKPSIGTMCWVIGWGLEKAKGAPKTPYSVQGVAVRIVNNEICNHRYQFLLLKNQ 209

  Fly   201 --------ICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC-TKGYPSVFTRIT 256
                    :|.....|..||...||..||..  :....|.:||.|:  ..|| .:.:||::|..:
  Rat   210 KKFIGNDMLCTSPEWGLDTCQDASGSSLVCQ--MNKTWIQMGVVSW--NFGCGRRQFPSIYTSTS 270

  Fly   257 AYLDWI 262
            .:..||
  Rat   271 HFTQWI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 57/251 (23%)
Prss46XP_006244055.1 Tryp_SPc 43..276 CDD:214473 57/251 (23%)
Tryp_SPc 44..279 CDD:238113 59/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.