DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk1c6

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038942515.1 Gene:Klk1c6 / 408242 RGDID:1303220 Length:262 Species:Rattus norvegicus


Alignment Length:278 Identity:81/278 - (29%)
Similarity:122/278 - (43%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLL 72
            :..|:|..||    :|.......|:.||.....|..|:||.:....      .||..||...:::
  Rat     5 ILFLVLSMGR----IDAAPPGQSRVVGGYKCEKNSQPWQVAVISRS------LCGGVLIDPSWVI 59

  Fly    73 TAAHCVEKAVAITYYLGGVLRL------APRQLIRSTNPEVHLHPDWN-----------CQSLEN 120
            |||||...|::..:.|.|...|      |..:.:..:.|    |||:|           .....|
  Rat    60 TAAHCYSNALSYYHVLLGRNNLSEDEPFAQYRFVSQSFP----HPDYNPFFMRNHTRQPGDDYSN 120

  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVES 185
            |:.|:.|.:.|.:.|.::.|.||.......|    ..:|||||........:.|:|:.|...:.|
  Rat   121 DLMLLHLSKPADITDGVKVIDLPTEEPKVGS----TCLASGWGSTKPLDWELPDDLQCVNIHLLS 181

  Fly   186 NEDCEYSYANIKPTNICM---DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKG 247
            ||.|..:| |.|.|::.:   |..|||.||.|||||||:..      .:|.|:||:|........
  Rat   182 NEKCIEAY-NEKVTDLMLCAGDLEGGKDTCKGDSGGPLICD------GVLQGITSWGSDPCAEPN 239

  Fly   248 YPSVFTRITAYLDWIGEV 265
            .|:::|::..:..||.||
  Rat   240 MPAIYTKLIKFTSWIKEV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/250 (29%)
Klk1c6XP_038942515.1 Tryp_SPc 25..257 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.