DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and MP1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:271 Identity:91/271 - (33%)
Similarity:131/271 - (48%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GHGIGGRIAGGELARANQFPYQVGLSIEEPNDMY-CWCGASLISDRYLLTAAHCVEKAVAITYYL 88
            |...|.|:.||......:||:...:...:|.::. ..||.|||:.||:||||||| .|:...:.|
  Fly   131 GENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCV-SAIPSDWEL 194

  Fly    89 GGVLRLAPRQLIRSTNPEVHL----------------------HPDW--NCQSLENDIALVRLPE 129
            .|| ||.  :...||||:..:                      ||.:  |.:...|||||:||.:
  Fly   195 TGV-RLG--EWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRD 256

  Fly   130 DALLCDSIRPIRLPGLSSSRNS-YDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY 193
            :....|.|.|:.||.|:|..|: :.....:.:||||.....|: :..|:.....|.::| |...|
  Fly   257 EVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTS-NIKLKAELDTVPTSE-CNQRY 319

  Fly   194 ANIKPT----NICMDTTGGKSTCTGDSGGPLV---YSDPVQNADILIGVTSYGKKSGCTKGYPSV 251
            |..:.|    .:|.....|..:|.|||||||:   ||:...|. .:.||.|||......||:|.|
  Fly   320 ATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNY-YIAGVVSYGPTPCGLKGWPGV 383

  Fly   252 FTRITAYLDWI 262
            :||:.|||:||
  Fly   384 YTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 87/263 (33%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 87/263 (33%)
Tryp_SPc 138..397 CDD:238113 88/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.