DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG14642

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:265 Identity:86/265 - (32%)
Similarity:128/265 - (48%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIAGGELARANQFPYQVGLSIEEPNDMYCW-CGASLISDRYLLTAAHCVE------KAVAITYY 87
            ||:    |||..::|:...:..|.......: ||.||||:|::||||||..      |.|.|   
  Fly   146 GRV----LARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI--- 203

  Fly    88 LGGVLRLAPR------QLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL---P 143
              |.|.||..      ||:|.  .:|..||::..:...:||||::|.::..|.:.:||:||   |
  Fly   204 --GDLDLASEKRSVEAQLLRI--EQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFP 264

  Fly   144 GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKP---------- 198
            .|.::       .|.|.|:| ....:..:::.|..:...|..|.:|.   |.:.|          
  Fly   265 ELPTT-------IAFAMGYG-ATSFAKPMTNRLTNLNLTVVPNAECN---AELPPLAETPSGVLE 318

  Fly   199 TNIC-MDTTGGKSTCTGDSGGPLVYSDPVQNAD-----ILIGVTSYGKKSGCTKGYPSVFTRITA 257
            :.|| .|....:.||.|||||||..:.|.:...     .|||:||||  ..|...||||:||:::
  Fly   319 SQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG--VFCRSSYPSVYTRVSS 381

  Fly   258 YLDWI 262
            :||||
  Fly   382 FLDWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/262 (32%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 86/265 (32%)
Tryp_SPc 146..386 CDD:214473 84/263 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.