DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG9372

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:246 Identity:85/246 - (34%)
Similarity:127/246 - (51%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEE--PNDMYCWCGASLISDRYLLTAAHCVEKA------VAITYY 87
            |:.||..|..:::|:...| ::|  |   :.|||..||:||::||||||:.|.      |.:..|
  Fly   173 RLTGGRPAEPDEWPWMAAL-LQEGLP---FVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEY 233

  Fly    88 LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLS---SSR 149
            ...:|.....:..|..|  :.||.|:|.|:.:||||:||:....:....|.|:.:|.::   |.|
  Fly   234 NTHMLNETRARDFRIAN--MVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDR 296

  Fly   150 NSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYA-NIKPTNICMD-TTGGKSTC 212
            |      ||.:|||........ |:.|..|...|....||..|:. ::..|.:|.. ..||:.:|
  Fly   297 N------AIVTGWGTQKFGGPH-SNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQDSC 354

  Fly   213 TGDSGGPLVYSDPVQNADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWI 262
            .|||||||:...|.|.. :.||:.|:|  .|| .:|.|.::||:..|||||
  Fly   355 QGDSGGPLLVQLPNQRW-VTIGIVSWG--VGCGQRGRPGIYTRVDRYLDWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/244 (34%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 83/244 (34%)
Tryp_SPc 176..402 CDD:238113 82/241 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.