DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG18223

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:298 Identity:81/298 - (27%)
Similarity:127/298 - (42%) Gaps:59/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQ-----------FPYQVGLSIEEPN 55
            :|.:.|:|||:|     :..||.|..||.........|.:.           ..|.|.:....|:
  Fly    11 KIFSFLLFLLLL-----LPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPH 70

  Fly    56 DMY---CWCGASLISDRYLLTAAHC-------VEKAVAITYYLGGVLRLAPRQLIRSTNPEVH-- 108
            .::   .:||..:||..|:||:|||       |.::..:....|...||..|:.: |.|.||.  
  Fly    71 KLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGL-SLNMEVKKI 134

  Fly   109 LHPDWNCQSLENDIALV----RLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI---ASGWGRMN 166
            ..||.......|:|||:    :||.|..|   :..|.||       :.|..|.:   ..||||:.
  Fly   135 FVPDKFTVFNTNNIALMMLAKKLPLDNPL---VGVINLP-------TADPEPGLNYTVLGWGRIF 189

  Fly   167 DESTAISDNLRYVYRFVESNEDCEYSYANIKPTNIC---MDTTGGKSTCTGDSGGPLVYSDPVQN 228
            ......||.|......: ..:.||......|...:|   ::.|..::.|.||:|.||::::.|  
  Fly   190 KGGPLASDILHIDVELL-PRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETV-- 251

  Fly   229 ADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWIGEV 265
                .||.||  :.|| :|..||::|.:..::|||..:
  Fly   252 ----FGVVSY--RVGCGSKTLPSIYTNVYMHMDWINGI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/264 (26%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 69/242 (29%)
Tryp_SPc 60..280 CDD:214473 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.