DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG6865

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:267 Identity:77/267 - (28%)
Similarity:120/267 - (44%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAV------------- 82
            :|.||..|..|:.||.|.|.....:    :||.::||:|::|||.||:...:             
  Fly    34 KIVGGSEAERNEMPYMVSLMRRGGH----FCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVV 94

  Fly    83 ---AITYYLGGV------LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIR 138
               :|..||.|:      ||:..:.::.        ||.::|..:::||||:.|.:.......|:
  Fly    95 GLHSIREYLNGIGNGPDALRVDFKNIVP--------HPQYDCNDVKHDIALLELVQPIRFSSHIQ 151

  Fly   139 PIRLPGLSSSRNSYDYVPAIASGWG--RMNDESTAISDNLRYVYRFVESNEDCEYSYAN------ 195
            | ...|......|.:......||||  ..|......||.||.....:.:||.||.||.:      
  Fly   152 P-SCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNT 215

  Fly   196 IKPTNICMDTTGGK-STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAY 258
            |..|.:|.....|: .:|..||||||:..:     ..|:||.|.|  .||.: |.|.::||::.|
  Fly   216 IGETQLCAGYENGQIDSCWADSGGPLMSKE-----HHLVGVVSTG--IGCARPGLPGIYTRVSKY 273

  Fly   259 LDWIGEV 265
            :.|:.:|
  Fly   274 VSWMQKV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/262 (29%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 75/261 (29%)
Tryp_SPc 35..280 CDD:238113 76/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.