DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG7542

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:238 Identity:100/238 - (42%)
Similarity:138/238 - (57%) Gaps:11/238 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAP 96
            |..||.|...|||||.||::...| ...|||.:|||..:::|||||::.|.::|.|||.: .:..
  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGN-WSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAI-NIGD 89

  Fly    97 -----RQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLP-GLSSSRNSYDYV 155
                 ::.|......:.:|.::...::.|||:|:|||......|.||...|| .|:....:|:.:
  Fly    90 ESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESI 154

  Fly   156 PAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE-YSYANIKPTNICMDTTGGKSTCTGDSGGP 219
            .|.||||||.:|.|.::|..||||...:..:..|. |....:....|||.||.|||||.||||||
  Fly   155 RAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGP 219

  Fly   220 LVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            |||..  .|:..|||.||:|...||..|:|:|||||::|||||
  Fly   220 LVYKQ--GNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 98/236 (42%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 100/238 (42%)
Tryp_SPc 27..260 CDD:214473 98/236 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.080

Return to query results.
Submit another query.