DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and proca

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:251 Identity:75/251 - (29%)
Similarity:120/251 - (47%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAP 96
            :.||.:.:..:.|:| .|.:......:  ||..||.:.::||||||:|.:...:      :||..
Zfish   195 VMGGNVGKRGESPWQ-ALILNHLGRFH--CGGVLIDENWVLTAAHCLETSSKFS------VRLGD 250

  Fly    97 RQLIRSTNPEVHL-------HPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSS-----R 149
            .|..:....||.|       ||.:|..:::|||||:||.........|.|..||.|..:     |
Zfish   251 YQRFKFEGSEVTLPVKQHISHPQYNPITVDNDIALLRLDGPVKFSTYILPACLPSLELAKRMLHR 315

  Fly   150 NSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC-EYSYANIKPTNICMDTTGG-KSTC 212
            |.   ...|.:|||:.|..:|:.:..|.||...:..|::| .:...|:....:|....|. |..|
Zfish   316 NG---TVTIITGWGKNNQSATSYNSTLHYVELPIVDNKECSRHMMNNLSDNMLCAGVLGQVKDAC 377

  Fly   213 TGDSGGPL--VYSDPVQNADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWIGEV 265
            .||||||:  ::.|    ...|:|:.|:|:  || .:....::|::.:|||||..|
Zfish   378 EGDSGGPMMTLFHD----TWFLVGLVSWGE--GCGQRDKLGIYTKVASYLDWIDSV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/246 (29%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342
Tryp_SPc 195..427 CDD:238113 74/249 (30%)
Tryp_SPc 197..424 CDD:214473 72/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.