DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and ovch1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:257 Identity:75/257 - (29%)
Similarity:118/257 - (45%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEK--------AVAITYY 87
            ||.||:.|.|:.:|:||.|   :.||:.. ||.:::...:::||.||.::        ||...:.
Zfish    56 RIIGGKEAWAHSWPWQVSL---QYNDVPT-CGGAILDQLWVITAGHCFKRYKKPSMWNAVVGLHN 116

  Fly    88 LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPI-----RLPGLSS 147
            |... ..:.|:.|:.  .::..|.::|.::.||||||::|....:....:|||     .||.|  
Zfish   117 LDNA-NESSRESIQV--QKIFSHKNYNQKTNENDIALLKLQSPLVFSKFVRPIGVFNNDLPPL-- 176

  Fly   148 SRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMDTT-GGKS 210
                   |....:|||.:.:.....| .|:.|...|...:.|...| ..:..:.||.... ||..
Zfish   177 -------VTCTVTGWGSVTENGPQAS-RLQEVNVTVYEPQKCNRFYRGKVLKSMICAGANEGGMD 233

  Fly   211 TCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGY-PSVFTRITAYLDWI-----GEVS 266
            .|.|||||||...|..:..  |.||.|:|  .||.:.. |.|:|.:..|..|:     ||::
Zfish   234 ACQGDSGGPLSCFDGERYK--LAGVVSWG--VGCGRAQKPGVYTTLYHYRQWMVSSMRGELA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/246 (29%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 72/245 (29%)
Tryp_SPc 57..281 CDD:238113 71/244 (29%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.