DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG18180

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:252 Identity:89/252 - (35%)
Similarity:129/252 - (51%) Gaps:20/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGA-SLISDRYLLTAAHCVE-KAVAITY 86
            :..|..|||..|..|...:.||.|||.|..........|| ::|::.::||||||:. ..|.|.|
  Fly    28 LSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHY 92

  Fly    87 YLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPE---DALLCDSIRPIRLPGLSSS 148
            ........|.||.:|..|  ...||||..|. ..||.|:|.|.   :.|    |..|.||.::..
  Fly    93 GSNWGWNGAYRQTVRRDN--FISHPDWPSQG-GRDIGLIRTPHVDFNGL----INKIPLPSMNEQ 150

  Fly   149 RNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCT 213
            .:.|.....:|.|||.|::.:  ::|.|:.|...:.||.:||.:|.::..|::|.....|||.|.
  Fly   151 NDRYQDTWCVACGWGGMDNGN--LADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCG 213

  Fly   214 GDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270
            ||||||||..|..:    |:||.::...| |..| ||.:||::.||:||.:.:|:.|
  Fly   214 GDSGGPLVTHDNAR----LVGVITFASVS-CHDG-PSGYTRVSDYLEWIRDQTGISY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/235 (35%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 83/235 (35%)
Tryp_SPc 36..259 CDD:238113 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.