DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG18179

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:249 Identity:88/249 - (35%)
Similarity:126/249 - (50%) Gaps:14/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGA-SLISDRYLLTAAHCV-EKAVAITY 86
            :..|..|||..|..|...:.||.|||.|..........|| ::|:..::||||||: ...|.|.|
  Fly    32 ISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHY 96

  Fly    87 YLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNS 151
            ........|.||.:|..|  ...||:|..:. ..||.|:|.|... ..|.|..:.||..|...:.
  Fly    97 GSNWGWNGAFRQSVRRDN--FISHPNWPAEG-GRDIGLIRTPSVG-FTDLINKVALPSFSEESDR 157

  Fly   152 YDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDS 216
            :.....:|.|||.|::.:  ::|.|:.:...:.||.:||.||..:..|::|...|.|||:|.|||
  Fly   158 FVDTWCVACGWGGMDNGN--LADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDS 220

  Fly   217 GGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270
            |||||..|..:    |:||.::|... |..| ||.:||:|.||.||.:.:|:.|
  Fly   221 GGPLVTHDNAR----LVGVITFGSVD-CHSG-PSGYTRVTDYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/232 (35%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 82/232 (35%)
Tryp_SPc 40..263 CDD:238113 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.