DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Jon66Ci

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:247 Identity:86/247 - (34%)
Similarity:120/247 - (48%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVL 92
            |.|||..|..|...:.||.|||.....    .|||.|:||:.::|||.||: ...|:|.|.|...
  Fly    33 IEGRITNGYPAEEGKAPYTVGLGFSGG----WWCGGSIISNEWVLTAEHCI-GGDAVTVYFGATW 92

  Fly    93 RLAPRQLIRSTNPE-VHLHPDWNCQSLEN-DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYV 155
            |         ||.: .|.....|..:..: ||||:|:|. ......:..:.||..:...|.|:..
  Fly    93 R---------TNAQFTHWVGSGNFITHGSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEW 147

  Fly   156 PAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE--YSYANIKPTNICMDTTGGKSTCTGDSGG 218
            .|:|.|||...|.| .:.|.|:.|...:..|.:|.  |....:....||:....||.||.|||||
  Fly   148 WAVACGWGGTYDGS-PLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGG 211

  Fly   219 PLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270
            |||..|    ...|:|||::...:||..|:|:.|.|:|.:||||.:.:|:.|
  Fly   212 PLVTHD----GSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIRDHTGIAY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 80/234 (34%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 80/234 (34%)
Tryp_SPc 37..254 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.