DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and sphinx2

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:270 Identity:70/270 - (25%)
Similarity:113/270 - (41%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGL-SIEEPNDMYCWCGASLISDR 69
            ::|.||:|....|: |  ..:.:..||.||..|:.....|.||: ..:.|.....:...::||::
  Fly     3 LVVALLVLSLTFSV-C--EKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQ 64

  Fly    70 YLLTAAHCVEKAVAITYYL----GGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPED 130
            ::||.     |.|.|..|:    |.........::|......:.|.|     ....||||:.|..
  Fly    65 WILTV-----KEVLIFKYIEAHFGSKRAFWGYDILRIYRENFYFHYD-----KTRIIALVKCPYQ 119

  Fly   131 ALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYAN 195
            .......| :|:|...:....|.....:..||| .:.....:...:|.|...|.:|.:|...:..
  Fly   120 KFDRRMSR-VRVPAYGARFERYVGNMTMVCGWG-TDKRKVRLPTWMRCVEVEVMNNTECAKYHTP 182

  Fly   196 IKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLD 260
            :|...:|....|.|..|.||.||.:|...|   ....||:. :...:.|:.|||||..|::.::.
  Fly   183 LKWYEMCTSGEGFKGVCEGDMGGAVVTMGP---NPTFIGII-WLMPTNCSIGYPSVHIRVSDHIK 243

  Fly   261 WIGEVSGVHY 270
            ||..||||.:
  Fly   244 WIKHVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 58/235 (25%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 58/235 (25%)
Tryp_SPc 26..248 CDD:304450 59/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.