DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG6592

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:249 Identity:101/249 - (40%)
Similarity:145/249 - (58%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG------ 89
            ||.||::...:.||||||:.::.|..:| |||.|||||::::||||||:.|.....:||      
  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLY-WCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKN 185

  Fly    90 ----GVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRN 150
                |.:||    ::.|.|  ..::|.||.:.|::|||:||||......:.|.||:||.......
  Fly   186 AKEKGQVRL----MVPSEN--FQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYR 244

  Fly   151 SYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMDTTGGKSTCTG 214
            |:....||||||||......|||:.||||...:.....|:.:: .:.:.||||......:|||.|
  Fly   245 SFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNG 309

  Fly   215 DSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGV 268
            |||||||.........:|:|:||:|...||.:|||:.||::.:|||||.:.:||
  Fly   310 DSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 97/241 (40%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 97/241 (40%)
Tryp_SPc 123..359 CDD:238113 98/242 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
99.070

Return to query results.
Submit another query.