DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:248 Identity:81/248 - (32%)
Similarity:123/248 - (49%) Gaps:24/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVL 92
            |.|||..|..|...:.||.|||...: |....|||.|:|.:.:::||.||.:...::|.|.|.:.
  Fly    34 IEGRITMGYPAYEGKVPYIVGLGFSK-NGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALW 97

  Fly    93 RLAPRQLIRSTNPEVHLHPDWNCQS--LEN---DIALVRLPEDALLCDSIRPIRLPGLSSSRNSY 152
            ||..:            :..|..:|  :|:   ||:|:|.|. ......:..:.||......|:|
  Fly    98 RLQAQ------------YTHWVGRSDFIEHGSGDISLIRTPH-VDFWSLVNKVELPRYDDRYNNY 149

  Fly   153 DYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSG 217
            ....|:.||||:.:||. .:|:.|..|...:..|..||..|.:.....||:.|...|.||:||||
  Fly   150 QGWWALVSGWGKTSDEG-GVSEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSG 213

  Fly   218 GPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270
            ||||    :.:.:..:|:.|:|..:||....|....|:|:|||||.:.:|:.|
  Fly   214 GPLV----IHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIRDNTGISY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/235 (32%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 75/235 (32%)
Tryp_SPc 41..257 CDD:238113 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
77.020

Return to query results.
Submit another query.