DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and KLK2

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:270 Identity:84/270 - (31%)
Similarity:126/270 - (46%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW--CGASLISDRYLLT 73
            |:|....|:.|......|..||.||.....:..|:||.:.      .:.|  ||..|:..:::||
Human     4 LVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVY------SHGWAHCGGVLVHPQWVLT 62

  Fly    74 AAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHL--HPDWNC-----QSL------ENDIALV 125
            ||||::|...:  :||......|....:.. |..|.  ||.:|.     |||      .:|:.|:
Human    63 AAHCLKKNSQV--WLGRHNLFEPEDTGQRV-PVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLL 124

  Fly   126 RLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE 190
            ||.|.|.:.|.::.:.||....:..:..|    |||||.:..|......:|:.|...:.||:.|.
Human   125 RLSEPAKITDVVKVLGLPTQEPALGTTCY----ASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCA 185

  Fly   191 YSYANIKPTN--ICMDT-TGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVF 252
            .:|:. |.|.  :|... ||||.||.||||||||.:      .:|.|:||:|.:.......|:|:
Human   186 RAYSE-KVTEFMLCAGLWTGGKDTCGGDSGGPLVCN------GVLQGITSWGPEPCALPEKPAVY 243

  Fly   253 TRITAYLDWI 262
            |::..|..||
Human   244 TKVVHYRKWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/248 (31%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.