DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG13430

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:260 Identity:84/260 - (32%)
Similarity:121/260 - (46%) Gaps:53/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYL------ 88
            |||.||.......||:||.|.:...:.    ||.::||...:|||||||.:.....||:      
  Fly    30 GRIVGGWETHITFFPHQVSLQLGTRHA----CGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSS 90

  Fly    89 -----GGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSS 148
                 |..:|:  :::|  .:||.|     :...:.||||:|:|.:..:....||||.|      
  Fly    91 DWTKGGSYIRV--KKII--PHPEFH-----DPTRMNNDIAIVQLQQPLVYSQDIRPISL------ 140

  Fly   149 RNSYDYVPAIA----SGWGRMNDESTAISD-----NLRYVYRFVESNEDCEYSY---ANIKPTNI 201
            ..|.|.:...|    ||||     ||:||.     .|||....:.....|..:|   ..:..|..
  Fly   141 ATSKDIIMPTAQLFVSGWG-----STSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMF 200

  Fly   202 CMDT-TGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKG-YPSVFTRITAYLDWIGE 264
            |..| .||:.:|.||||||||.|  :.....|.|:.|:|  .||... :|.::|:::||.|||.:
  Fly   201 CAGTQAGGRDSCQGDSGGPLVTS--IDGRLKLYGIVSWG--FGCANAMFPGIYTKVSAYDDWIAQ 261

  Fly   265  264
              Fly   262  261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 81/255 (32%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 81/255 (32%)
Tryp_SPc 32..262 CDD:238113 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.920

Return to query results.
Submit another query.