DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG32269

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:245 Identity:71/245 - (28%)
Similarity:109/245 - (44%) Gaps:36/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYL-GGV 91
            |..||.||.....:..||.|  .:...:::   |..|||:::::|||||||:...|..:.: ||.
  Fly   105 IQSRIVGGTSTTISTTPYIV--QLRRGSNL---CSGSLITEQWVLTAAHCVKGYSASDFTVRGGT 164

  Fly    92 LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSY-DYV 155
            ..|.....:..:...:|:.|.:..:.:..|.||::|.:.           |.|.:....|. :|.
  Fly   165 TTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQS-----------LTGTNIGTISMGNYR 218

  Fly   156 PAIAS-----GWGRMNDESTAISDNLRYVYRFVESNEDCEYSY---ANIKPTNICMDTTGGKSTC 212
            |...|     |||...:.||..|..|:.....|...:.|...|   |.|....:|. ...||.:|
  Fly   219 PKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCA-RAAGKDSC 282

  Fly   213 TGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDW 261
            :|||||      ||...:.|:|:.|:|  .||.: |||.|:|.:.|...|
  Fly   283 SGDSGG------PVTRNNTLLGIVSFG--YGCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/242 (29%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 69/240 (29%)
Tryp_SPc 121..324 CDD:238113 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.