DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG13527

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:251 Identity:61/251 - (24%)
Similarity:110/251 - (43%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ELARANQFPYQVGLSIEEPNDMY---CWCGASLISDRYLLTAAHCVEKAVAITY------YLGGV 91
            |||:     |.|.:....||..:   .:||..|:|:::::||||||.....|.|      .:.|.
  Fly    39 ELAK-----YVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGS 98

  Fly    92 ---LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYD 153
               ||..|.:.:.|....:::..::...:..| :||::|.|           ::|. :..|..:.
  Fly    99 PHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFN-MALMKLQE-----------KMPS-NDPRIGFL 150

  Fly   154 YVPAIAS---------GWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICM---DTT 206
            ::|..|.         |||||. ....::.::..|...:..|..|:..:.:.....:|.   :.|
  Fly   151 HLPKEAPKIGIRHTVLGWGRMY-FGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWT 214

  Fly   207 GGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            .....|:||.|.||:      :..:::|:.:|....||| ..|||:|.:.:.|.||
  Fly   215 IDAEPCSGDIGSPLL------SGKVVVGIVAYPIGCGCT-NIPSVYTDVFSGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 59/249 (24%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 58/242 (24%)
Tryp_SPc 43..263 CDD:214473 56/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.