DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Tmprss11b

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001004020.1 Gene:Tmprss11b / 365265 RGDID:1303278 Length:420 Species:Rattus norvegicus


Alignment Length:269 Identity:73/269 - (27%)
Similarity:120/269 - (44%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            ||.||..|:..::|:|..|.:...:.    ||||||.:|:|||||||                  
  Rat   188 RITGGSTAQKGEWPWQASLRVNGKHH----CGASLIGERFLLTAAHC------------------ 230

  Fly    96 PRQLIRSTNP---------------------EVHLHPDWNCQSLENDIALVRLPEDALLCDSIRP 139
               .:|:.||                     ||.:|.|:......:|:|:::|.|.....:.:..
  Rat   231 ---FLRTNNPKNLTVSFGTRVTPAYMQHYVEEVIIHEDYVKGQHHDDVAIIKLTEKVSFRNDVHR 292

  Fly   140 IRLPGLSSSRNSYDYVP---AIASGWGRM--NDESTAISDNLRYVYRFVESNE-DCEYSY-ANIK 197
            :.||..:..     :.|   .:.:|||.:  |.:|..:..  :...:.:::|. :.|.:| ..|.
  Rat   293 VCLPEATQV-----FPPGEGVVVTGWGSLSYNGKSPLLLQ--KASIKIIDTNACNSEEAYGGRIM 350

  Fly   198 PTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADI--LIGVTSYGKKSGCTKGYPSVFTRITAYL 259
            .|.:|.. ..|....|.||||||||:.:   :.||  |:|:.|:|.:.| ....|.|:.|:|:|.
  Rat   351 DTMLCAGYMEGYVDACQGDSGGPLVHPN---SRDIWYLVGIVSWGHECG-RVNKPGVYMRVTSYR 411

  Fly   260 DWIGEVSGV 268
            |||...:|:
  Rat   412 DWIASKTGI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/261 (27%)
Tmprss11bNP_001004020.1 SEA 50..144 CDD:279699
Tryp_SPc 188..414 CDD:214473 70/261 (27%)
Tryp_SPc 189..417 CDD:238113 71/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.