DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss56

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:248 Identity:80/248 - (32%)
Similarity:120/248 - (48%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIAGGELARANQFPYQV-----GLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG 89
            |||.||..|....:|:.|     ||.:         ||..|::..::||||||.  |.|....|.
  Rat   110 GRIVGGSTAPLGAWPWLVRLQLGGLPL---------CGGVLVAASWVLTAAHCF--AGASNELLW 163

  Fly    90 GVLRLAPRQLIRSTNPEVHL---HPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNS 151
            .|:.....|..::...:|:.   ||.::.|:..||:|||:|..........|||.||  ..||..
  Rat   164 TVMLAEGPQGEQAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVNSEGPARPICLP--EGSREP 226

  Fly   152 YDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYA-NIKP-TNICMD-TTGGKSTCT 213
            ....|...:|||.:.::... |:.:|.....:.|.:.|:.:.. .:.| |.:|.. ..||..:|.
  Rat   227 PAGTPCTIAGWGALFEDGPE-SEAVREARVPLLSADTCQKALGPGLSPSTMLCAGYLAGGIDSCQ 290

  Fly   214 GDSGGPLVYSDP-VQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWIGE 264
            |||||||..|:| .:..::|.||||:|  .||.: |.|.|:||:..:.||:.|
  Rat   291 GDSGGPLTCSEPGPRPREVLFGVTSWG--DGCGEPGKPGVYTRVAVFKDWLQE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/243 (32%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.