DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Ctrc

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:245 Identity:86/245 - (35%)
Similarity:124/245 - (50%) Gaps:20/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG-GVLRL 94
            |:.|||.|..|.:|:||.|...:.:.....||.|||:..::||||||:.|  ..||.:| |...|
  Rat    29 RVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSLITTSHVLTAAHCINK--DFTYRVGLGKYNL 91

  Fly    95 APRQLIRSTNPEV---HLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVP 156
            .......|...||   ::|..||...|.||||:::|.|...|.::|:...:|. ..|....|| |
  Rat    92 TVEDEEGSVYAEVDTIYVHEKWNRLFLWNDIAIIKLAEPVELSNTIQVACIPE-EGSLLPQDY-P 154

  Fly   157 AIASGWGRMNDESTAISDNLRYVYRFVESNEDC---EYSYANIKPTNICMDTTGGKSTCTGDSGG 218
            ...:||||:.... .|::.|:...:.:.|:..|   ::.:..::.|.:|....|..|.|.|||||
  Rat   155 CYVTGWGRLWTNG-PIAEVLQQGLQPIVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGG 218

  Fly   219 PLVYSDPVQNAD---ILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWIGE 264
            ||    ..|..|   .:.|:.|:|..||| ....|.||||::||.|||.|
  Rat   219 PL----NCQAEDGSWQVHGIVSFGSSSGCNVHKKPVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/241 (34%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 83/241 (34%)
Tryp_SPc 30..265 CDD:238113 85/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.