DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG12133

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:269 Identity:87/269 - (32%)
Similarity:122/269 - (45%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQVGLSIE------EPNDMYCWCGASLISDRYLLTAAHCV------------ 78
            |.||..|::||||:.|.|..|      .|:.|   |..|||:.||:||||||:            
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPM---CAGSLIASRYVLTAAHCLNVNDFYVARVRL 123

  Fly    79 -----EKAVAITYYLGGVLRLAPRQLIRSTNPEVHL---HPDWNCQSLE--NDIALVRLPEDALL 133
                 |.....|:...|....||..:    :.:|.|   |..:..::..  |||||:||......
  Fly   124 GEHDTENDPDYTWLPNGAKIWAPAHV----DIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKY 184

  Fly   134 CDSIRPIRL-PGLSSSRNSYDYVPAIASGWG--RMNDESTAISDNLRYVYRFVESNEDCEYSYAN 195
            ...||||.: ||:..|.:|:...|...:|||  .:..:||.    ||.......|.::|...|..
  Fly   185 TLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTV----LRQGTISGMSPDECLNRYPT 245

  Fly   196 I---KPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNAD---ILIGVTSYGKKSGCTKGY-PSVFT 253
            :   |...||.....|..|..||||.||:.| ..:.||   .|.|:|||| ....:.|| |:|:|
  Fly   246 LLVDKDIQICAMGWDGTDTGLGDSGSPLMAS-VGRGADQFYYLAGITSYG-GGPSSYGYGPAVYT 308

  Fly   254 RITAYLDWI 262
            :.::|.:||
  Fly   309 KTSSYYEWI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 85/267 (32%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 87/269 (32%)
Tryp_SPc 62..317 CDD:214473 85/267 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.