DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and TMPRSS9

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:245 Identity:77/245 - (31%)
Similarity:117/245 - (47%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVE--------KAVAITYY 87
            ||.||..|...::|:||.|.:......   |||.|:::|:||:||||.:        .|...|.:
Human   860 RIVGGSAAGRGEWPWQVSLWLRRREHR---CGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPF 921

  Fly    88 LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSY 152
            |.|    |..||.|..  .::.||.:|..:|:.|:||:.|.........:|||.||  ..:....
Human   922 LSG----AEGQLERVA--RIYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLP--EPAPRPP 978

  Fly   153 DYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMD-TTGGKSTCTGD 215
            |....:.:|||.:.:..:......:...|.: |.:.|...| ..|....:|.. ..||..:|:||
Human   979 DGTRCVITGWGSVREGGSMARQLQKAAVRLL-SEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGD 1042

  Fly   216 SGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWIGE 264
            :||||...:| ....:|.||||:|  .||.: .:|.|:||:.|...|||:
Human  1043 AGGPLACREP-SGRWVLTGVTSWG--YGCGRPHFPGVYTRVAAVRGWIGQ 1089

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/241 (31%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.