DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and scaf

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:236 Identity:52/236 - (22%)
Similarity:98/236 - (41%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVE-------KAVAITYYLGGVLRLAPRQL 99
            :.|:|..:..|....:.  ||.::|.|:::|::|.||.       :..|..:.||......|.||
  Fly   433 EIPWQAMILRESSKTLI--CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQL 495

  Fly   100 --IRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGW 162
              :::    |.:|||::..:..:|:|::||.........|:||.:    |..:..|......|||
  Fly   496 TGVKT----VDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICI----SDEDPKDSEQCFTSGW 552

  Fly   163 GR----MNDESTA--ISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLV 221
            |:    :::|...  ::|.|      .::..:|     :...:::|..|.  ..:|..|.|..|.
  Fly   553 GKQALSIHEEGALMHVTDTL------PQARSEC-----SADSSSVCSATK--FDSCQFDVGSALA 604

  Fly   222 --YSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLD 260
              ....|:...|..|..|.|:........|.:....||:.:
  Fly   605 CGSGSSVRLKGIFAGENSCGEGQTVRFAKPDIKWINTAFAE 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 52/236 (22%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 45/205 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.