DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG17572

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:296 Identity:70/296 - (23%)
Similarity:111/296 - (37%) Gaps:87/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VQGRSISCLDMGH---GIGGRIAGGELARANQFPYQVGLSIEEPN-DMYCW-CGASLISDRYLLT 73
            |.|:|   |..||   |:|            .:|:...:..:..| ..:.: |..::|:.|.:||
  Fly   123 VCGKS---LVQGHFYKGLG------------SYPFVARIGFKHVNTGAFAYPCAGAVIARRVILT 172

  Fly    74 AAHCVEKAVAITYYLGGVLRL-----------------APRQLIRSTNPEVHLHPDWNCQSLEND 121
            ||||. .|.|..:.|..| |:                 |||.:..:.: .|.:|||:......:|
  Fly   173 AAHCA-LAKADGHRLSSV-RVGEYDTSSDPDCANTGFCAPRSVNHAIS-HVIVHPDYKQGQYHHD 234

  Fly   122 IALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESN 186
            |||:.|........:.:||.|.  .:..|......|..:|||:|:..|.                
  Fly   235 IALLVLKTPLNYSVATQPICLQ--KTRANLVVGKRATIAGWGKMSTSSV---------------- 281

  Fly   187 EDCEYSYANIKPT--NICMDTTG---------------------GKSTCTGDSGGPLVYSDPVQN 228
            ...|.|:.::..|  ::|:...|                     ||..|.|..|.||.    :|.
  Fly   282 RQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPLF----IQE 342

  Fly   229 ADIL--IGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            ..|.  ||:.|:|..:......|||:|.:..:.:||
  Fly   343 NGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 60/274 (22%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 63/278 (23%)
Tryp_SPc 138..378 CDD:214473 61/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.